![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (10 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Chymosin (synonym: renin) [50667] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50668] (4 PDB entries) |
![]() | Domain d1czie_: 1czi E: [26868] complexed with nor |
PDB Entry: 1czi (more details), 2.3 Å
SCOP Domain Sequences for d1czie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czie_ b.50.1.2 (E:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd vfireyysvfdrannlvglakai
Timeline for d1czie_: