SCOP 1.71: Domain d1czie_: 1czi E:

Lineage for d1czie_ (1czi E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Chymosin (synonym: renin) [50667] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50668] (4 PDB entries)

8. Domain d1czie_: 1czi E: [26868]
   complexed with nor

Details for d1czie_

PDB Entry: 1czi, 2.3 Å

PDB Description: chymosin complex with the inhibitor cp-113972

SCOP Domain Sequences for d1czie_:

Sequence; same for both SEQRES and ATOM records:

>d1czie_ b.50.1.2 (E:) Chymosin (synonym: renin) {Cow (Bos taurus)}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai

Timeline for d1czie_:

• d1czie_ first appeared (with stable ids) in SCOP 1.55
  
• d1czie_ appears in SCOP 1.69
  
• d1czie_ appears in SCOP 1.73
  
• d1czie_ appears in the current release, SCOPe 2.08