Lineage for d4r20b1 (4r20 B:53-495)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006029Species Zebrafish (Danio rerio) [TaxId:7955] [194761] (4 PDB entries)
  8. 2006037Domain d4r20b1: 4r20 B:53-495 [268679]
    Other proteins in same PDB: d4r20b2
    automated match to d3pm0a_
    complexed with aer, hem, hg

Details for d4r20b1

PDB Entry: 4r20 (more details), 2.86 Å

PDB Description: zebra fish cytochrome p450 17a2 with abiraterone
PDB Compounds: (B:) Cytochrome P450 family 17 polypeptide 2

SCOPe Domain Sequences for d4r20b1:

Sequence, based on SEQRES records: (download)

>d4r20b1 a.104.1.0 (B:53-495) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
nlpphllftqlssqygplfglyagphltlvvseiglvrevllqrgrefagrpkmvttdll
tqggkdiafadysplwknhrrlvhssftlfgegsnklqtivqeaadslceelqacrgqss
dlsvvlmravtnvicrlvfsssyqpsdpelqtviqyndgivqtiargglvdifpwlrifp
nkdlkrlkecvsirdqllykkllehkksltpgeprdlldalligqqrgsggadditedhv
lmtaaeafgagvettsttllwtiafllhhpqlqervqaeldecvgvdrppclsdrphlpl
ldavlcevmrirpvspiliphvamqdtslgghsvpkgtrvlvnmwaihhdpkhwdqpeqf
nperflepsgkkktqssflpfgagprvcvgeslarielflfvsrplqrfsfscpseaslp
dlqgrfgvvlqperytvtvtprh

Sequence, based on observed residues (ATOM records): (download)

>d4r20b1 a.104.1.0 (B:53-495) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
nlpphllftqlssqygplfglyagphltlvvseiglvrevllqrgrefagrpkmvttdll
tqggkdiafadysplwknhrrlvhssftlklqtivqeaadslceelqacrgqssdlsvvl
mravtnvicrlvfsssyqpsdpelqtviqyndgivqtiardlkrlkecvsirdqllykkl
lehkksltpgeprdlldalligqqrgsggadditedhvlmtaaeafgagvettsttllwt
iafllhhpqlqervqaeldecvgvdrppclsdrphlplldavlcevmrirpvspiliphv
amqdtslgghsvpkgtrvlvnmwaihhdpkhwdqpeqfnperflqssflpfgagprvcvg
eslarielflfvsrplqrfsfscpseaslpdlqgrfgvvlqperytvtvtprh

SCOPe Domain Coordinates for d4r20b1:

Click to download the PDB-style file with coordinates for d4r20b1.
(The format of our PDB-style files is described here.)

Timeline for d4r20b1:

  • d4r20b1 first appeared in SCOPe 2.05, called d4r20b_

View in 3D
Domains from same chain:
(mouse over for more information)
d4r20b2
View in 3D
Domains from other chains:
(mouse over for more information)
d4r20a_