Lineage for d1cmsa_ (1cms A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1797457Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1797924Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 1797925Species Cow (Bos taurus) [TaxId:9913] [50668] (6 PDB entries)
  8. 1797930Domain d1cmsa_: 1cms A: [26867]

Details for d1cmsa_

PDB Entry: 1cms (more details), 2.3 Å

PDB Description: the three-dimensional structure of recombinant bovine chymosin at 2.3 angstroms resolution
PDB Compounds: (A:) prochymosin a/b precursor

SCOPe Domain Sequences for d1cmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai

SCOPe Domain Coordinates for d1cmsa_:

Click to download the PDB-style file with coordinates for d1cmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1cmsa_: