Lineage for d1cmsa_ (1cms A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 804499Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 804661Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 804662Species Cow (Bos taurus) [TaxId:9913] [50668] (4 PDB entries)
  8. 804664Domain d1cmsa_: 1cms A: [26867]

Details for d1cmsa_

PDB Entry: 1cms (more details), 2.3 Å

PDB Description: the three-dimensional structure of recombinant bovine chymosin at 2.3 angstroms resolution
PDB Compounds: (A:) prochymosin a/b precursor

SCOP Domain Sequences for d1cmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai

SCOP Domain Coordinates for d1cmsa_:

Click to download the PDB-style file with coordinates for d1cmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1cmsa_: