Lineage for d4cmsa_ (4cms A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060652Species Cow (Bos taurus) [TaxId:9913] [50668] (6 PDB entries)
  8. 2060656Domain d4cmsa_: 4cms A: [26866]

Details for d4cmsa_

PDB Entry: 4cms (more details), 2.2 Å

PDB Description: x-ray analyses of aspartic proteinases iv. structure and refinement at 2.2 angstroms resolution of bovine chymosin
PDB Compounds: (A:) chymosin b

SCOPe Domain Sequences for d4cmsa_:

Sequence, based on SEQRES records: (download)

>d4cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai

Sequence, based on observed residues (ATOM records): (download)

>d4cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqseqkwilgdvfi
reyysvfdrannlvglakai

SCOPe Domain Coordinates for d4cmsa_:

Click to download the PDB-style file with coordinates for d4cmsa_.
(The format of our PDB-style files is described here.)

Timeline for d4cmsa_: