Lineage for d1lyw.4 (1lyw G:,H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1549928Protein Cathepsin D [50665] (1 species)
  7. 1549929Species Human (Homo sapiens) [TaxId:9606] [50666] (3 PDB entries)
  8. 1549937Domain d1lyw.4: 1lyw G:,H: [26864]
    complexed with epe

Details for d1lyw.4

PDB Entry: 1lyw (more details), 2.5 Å

PDB Description: cathepsin d at ph 7.5
PDB Compounds: (G:) cathepsin d, (H:) cathepsin d

SCOPe Domain Sequences for d1lyw.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lyw.4 b.50.1.2 (G:,H:) Cathepsin D {Human (Homo sapiens) [TaxId: 9606]}
ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd
ksstyvkngtsfdihygsgslsgylsqdtvsvpcqXggvkverqvfgeatkqpgitfiaa
kfdgilgmayprisvnnvlpvfdnlmqqklvdqnifsfylsrdpdaqpggelmlggtdsk
yykgslsylnvtrkaywqvhldqvevasgltlckegceaivdtgtslmvgpvdevrelqk
aigavpliqgeymipcekvstlpaitlklggkgyklspedytlkvsqagktlclsgfmgm
dipppsgplwilgdvfigryytvfdrdnnrvgfaeaa

SCOPe Domain Coordinates for d1lyw.4:

Click to download the PDB-style file with coordinates for d1lyw.4.
(The format of our PDB-style files is described here.)

Timeline for d1lyw.4: