Lineage for d1lyw.4 (1lyw G:,H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16031Protein Cathepsin D [50665] (1 species)
  7. 16032Species Human (Homo sapiens) [TaxId:9606] [50666] (3 PDB entries)
  8. 16040Domain d1lyw.4: 1lyw G:,H: [26864]

Details for d1lyw.4

PDB Entry: 1lyw (more details), 2.5 Å

PDB Description: cathepsin d at ph 7.5
PDB Compounds: (G:) , (H:)

SCOP Domain Sequences for d1lyw.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lyw.4 b.50.1.2 (G:,H:) Cathepsin D {Human (Homo sapiens)}
ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd
ksstyvkngtsfdihygsgslsgylsqdtvsvpcqXggvkverqvfgeatkqpgitfiaa
kfdgilgmayprisvnnvlpvfdnlmqqklvdqnifsfylsrdpdaqpggelmlggtdsk
yykgslsylnvtrkaywqvhldqvevasgltlckegceaivdtgtslmvgpvdevrelqk
aigavpliqgeymipcekvstlpaitlklggkgyklspedytlkvsqagktlclsgfmgm
dipppsgplwilgdvfigryytvfdrdnnrvgfaeaa

SCOP Domain Coordinates for d1lyw.4:

Click to download the PDB-style file with coordinates for d1lyw.4.
(The format of our PDB-style files is described here.)

Timeline for d1lyw.4: