Lineage for d4qy0j_ (4qy0 J:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970048Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries)
  8. 1970073Domain d4qy0j_: 4qy0 J: [268638]
    Other proteins in same PDB: d4qy0a_, d4qy0c_, d4qy0e_, d4qy0g_, d4qy0i_, d4qy0k_
    automated match to d4d00d_
    complexed with nag

Details for d4qy0j_

PDB Entry: 4qy0 (more details), 2.47 Å

PDB Description: structure of h10 from human-infecting h10n8
PDB Compounds: (J:) Hemagglutinin

SCOPe Domain Sequences for d4qy0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy0j_ h.3.1.1 (J:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin

SCOPe Domain Coordinates for d4qy0j_:

Click to download the PDB-style file with coordinates for d4qy0j_.
(The format of our PDB-style files is described here.)

Timeline for d4qy0j_: