Lineage for d4qy0e_ (4qy0 E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778592Species Influenza A virus [TaxId:11320] [187142] (19 PDB entries)
  8. 1778613Domain d4qy0e_: 4qy0 E: [268636]
    Other proteins in same PDB: d4qy0b_, d4qy0d_, d4qy0f_, d4qy0h_, d4qy0j_, d4qy0l_
    automated match to d4cyza_
    complexed with nag

Details for d4qy0e_

PDB Entry: 4qy0 (more details), 2.47 Å

PDB Description: structure of h10 from human-infecting h10n8
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4qy0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy0e_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqsisisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d4qy0e_:

Click to download the PDB-style file with coordinates for d4qy0e_.
(The format of our PDB-style files is described here.)

Timeline for d4qy0e_: