![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Cathepsin D [50665] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50666] (3 PDB entries) |
![]() | Domain d1lyw.3: 1lyw E:,F: [26863] complexed with epe |
PDB Entry: 1lyw (more details), 2.5 Å
SCOPe Domain Sequences for d1lyw.3:
Sequence; same for both SEQRES and ATOM records: (download)
>g1lyw.3 b.50.1.2 (E:,F:) Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd ksstyvkngtsfdihygsgslsgylsqdtvsvpcqXggvkverqvfgeatkqpgitfiaa kfdgilgmayprisvnnvlpvfdnlmqqklvdqnifsfylsrdpdaqpggelmlggtdsk yykgslsylnvtrkaywqvhldqvevasgltlckegceaivdtgtslmvgpvdevrelqk aigavpliqgeymipcekvstlpaitlklggkgyklspedytlkvsqagktlclsgfmgm dipppsgplwilgdvfigryytvfdrdnnrvgfaeaa
Timeline for d1lyw.3: