Lineage for d4qy0l_ (4qy0 L:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041720Domain d4qy0l_: 4qy0 L: [268628]
    Other proteins in same PDB: d4qy0a_, d4qy0c_, d4qy0e_, d4qy0g_, d4qy0i_, d4qy0k_
    automated match to d4d00d_
    complexed with nag

Details for d4qy0l_

PDB Entry: 4qy0 (more details), 2.47 Å

PDB Description: structure of h10 from human-infecting h10n8
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d4qy0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy0l_ h.3.1.1 (L:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin

SCOPe Domain Coordinates for d4qy0l_:

Click to download the PDB-style file with coordinates for d4qy0l_.
(The format of our PDB-style files is described here.)

Timeline for d4qy0l_: