Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries) |
Domain d4qy0l_: 4qy0 L: [268628] Other proteins in same PDB: d4qy0a_, d4qy0c_, d4qy0e_, d4qy0g_, d4qy0i_, d4qy0k_ automated match to d4d00d_ complexed with nag |
PDB Entry: 4qy0 (more details), 2.47 Å
SCOPe Domain Sequences for d4qy0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qy0l_ h.3.1.1 (L:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
Timeline for d4qy0l_: