![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries) |
![]() | Domain d4qy0g_: 4qy0 G: [268625] Other proteins in same PDB: d4qy0b_, d4qy0d_, d4qy0f_, d4qy0h_, d4qy0j_, d4qy0l_ automated match to d4cyza_ complexed with nag |
PDB Entry: 4qy0 (more details), 2.47 Å
SCOPe Domain Sequences for d4qy0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qy0g_ b.19.1.2 (G:) automated matches {Influenza A virus, different strains [TaxId: 11320]} dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqsisisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnrrslmlatgmrnvpe
Timeline for d4qy0g_: