Lineage for d4qsja_ (4qsj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1804999Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1805680Protein automated matches [190681] (2 species)
    not a true protein
  7. 1805690Species Human (Homo sapiens) [TaxId:9606] [187805] (18 PDB entries)
  8. 1805696Domain d4qsja_: 4qsj A: [268620]
    automated match to d3d0na_
    complexed with cit, dms, edo, eww, ni, peg, zn

Details for d4qsja_

PDB Entry: 4qsj (more details), 1.7 Å

PDB Description: Crystal structure of human carbonic anhydrase isozyme XIII with 2-chloro-4-{[(4-methyl-6-oxo-1,6-dihydropyrimidin-2-yl)thio]acetyl}benzenesulfonamide
PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d4qsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qsja_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisn
sghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvv
hwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdl
lsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaafl
vsnhrppqplkgrkvrasfh

SCOPe Domain Coordinates for d4qsja_:

Click to download the PDB-style file with coordinates for d4qsja_.
(The format of our PDB-style files is described here.)

Timeline for d4qsja_: