Lineage for d4qnba2 (4qnb A:148-219)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1992228Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1992302Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1992303Protein automated matches [191156] (10 species)
    not a true protein
  7. 1992324Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232387] (4 PDB entries)
  8. 1992326Domain d4qnba2: 4qnb A:148-219 [268616]
    Other proteins in same PDB: d4qnba1
    automated match to d2m8pa2
    complexed with 1b0

Details for d4qnba2

PDB Entry: 4qnb (more details), 2 Å

PDB Description: disulfide stabilized hiv-1 ca hexamer in complex with phenyl-l-phenylalaninamide inhibitor
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4qnba2:

Sequence, based on SEQRES records: (download)

>d4qnba2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d4qnba2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevtetllvqnanpdcktilkalgpgatl
eemmtacq

SCOPe Domain Coordinates for d4qnba2:

Click to download the PDB-style file with coordinates for d4qnba2.
(The format of our PDB-style files is described here.)

Timeline for d4qnba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qnba1