SCOPe 2.06: Domain d4qnba1: 4qnb A:1-147

Lineage for d4qnba1 (4qnb A:1-147)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d4qnba1: 4qnb A:1-147 [268615]
   Other proteins in same PDB: d4qnba2
   automated match to d2m8la1
   complexed with 1b0

Details for d4qnba1

PDB Entry: 4qnb, 2 Å

PDB Description: disulfide stabilized hiv-1 ca hexamer in complex with phenyl-l-phenylalaninamide inhibitor

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4qnba1:

Sequence; same for both SEQRES and ATOM records:

>d4qnba1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Timeline for d4qnba1:

• d4qnba1 first appeared in SCOPe 2.05
  
• d4qnba1 appears in SCOPe 2.07
  
• d4qnba1 appears in the current release, SCOPe 2.08