SCOPe 2.08: Domain d4qqua2: 4qqu A:404-767

Lineage for d4qqua2 (4qqu A:404-767)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.22: UROD/MetE-like [51726] (3 families)

5. Family c.1.22.0: automated matches [191464] (1 protein)
   not a true family

6. Protein automated matches [190717] (5 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [267869] (5 PDB entries)

8. Domain d4qqua2: 4qqu A:404-767 [268614]
   automated match to d3ppha2
   complexed with 39s, hcs, po4, zn

Details for d4qqua2

PDB Entry: 4qqu, 2.98 Å

PDB Description: Crystal structure of the cobalamin-independent methionine synthase enzyme in a closed conformation

PDB Compounds: (A:) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

SCOPe Domain Sequences for d4qqua2:

Sequence; same for both SEQRES and ATOM records:

>d4qqua2 c.1.22.0 (A:404-767) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirinrnkfa
kgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngw
vqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddv
sgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaaqsfrv
atsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnhiglgl
fdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmveaakef
raky

Timeline for d4qqua2:

• d4qqua2 first appeared in SCOPe 2.05
  
• d4qqua2 appears in SCOPe 2.07