Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.22: UROD/MetE-like [51726] (3 families) |
Family c.1.22.0: automated matches [191464] (1 protein) not a true family |
Protein automated matches [190717] (5 species) not a true protein |
Species Yeast (Candida albicans) [TaxId:5476] [267869] (5 PDB entries) |
Domain d4qqua2: 4qqu A:404-767 [268614] automated match to d3ppha2 complexed with 39s, hcs, po4, zn |
PDB Entry: 4qqu (more details), 2.98 Å
SCOPe Domain Sequences for d4qqua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qqua2 c.1.22.0 (A:404-767) automated matches {Yeast (Candida albicans) [TaxId: 5476]} dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirinrnkfa kgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngw vqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddv sgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaaqsfrv atsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnhiglgl fdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmveaakef raky
Timeline for d4qqua2: