SCOPe 2.05: Domain d1lya.2: 1lya C:,D:

Lineage for d1lya.2 (1lya C:,D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Cathepsin D [50665] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50666] (3 PDB entries)

8. Domain d1lya.2: 1lya C:,D: [26860]
   complexed with nag

Details for d1lya.2

PDB Entry: 1lya, 2.5 Å

PDB Description: crystal structures of native and inhibited forms of human cathepsin d: implications for lysosomal targeting and drug design

PDB Compounds: (C:) cathepsin d, (D:) cathepsin d

SCOPe Domain Sequences for d1lya.2:

Sequence; same for both SEQRES and ATOM records:

>g1lya.2 b.50.1.2 (C:,D:) Cathepsin D {Human (Homo sapiens) [TaxId: 9606]}
gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
sdksstyvkngtsfdihygsgslsgylsqdtvsvpcqXggvkverqvfgeatkqpgitfi
aakfdgilgmayprisvnnvlpvfdnlmqqklvdqnifsfylsrdpdaqpggelmlggtd
skyykgslsylnvtrkaywqvhldqvevasgltlckegceaivdtgtslmvgpvdevrel
qkaigavpliqgeymipcekvstlpaitlklggkgyklspedytlkvsqagktlclsgfm
gmdipppsgplwilgdvfigryytvfdrdnnrvgfaeaa

Timeline for d1lya.2:

• d1lya.2 first appeared (with stable ids) in SCOP 1.55
  
• d1lya.2 appears in SCOPe 2.04
  
• d1lya.2 appears in SCOPe 2.06
  
• d1lya.2 appears in the current release, SCOPe 2.08