Lineage for d4oz4b1 (4oz4 B:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761209Domain d4oz4b1: 4oz4 B:1-112 [268593]
    Other proteins in same PDB: d4oz4a1, d4oz4a2, d4oz4b2, d4oz4h1, d4oz4h2, d4oz4l2
    automated match to d3hzma1

Details for d4oz4b1

PDB Entry: 4oz4 (more details), 3 Å

PDB Description: x-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.
PDB Compounds: (B:) Fab of monoclonal antibody, light chain

SCOPe Domain Sequences for d4oz4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oz4b1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

SCOPe Domain Coordinates for d4oz4b1:

Click to download the PDB-style file with coordinates for d4oz4b1.
(The format of our PDB-style files is described here.)

Timeline for d4oz4b1: