SCOPe 2.08: Domain d4oz4l1: 4oz4 L:1-112

Lineage for d4oz4l1 (4oz4 L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4oz4l1: 4oz4 L:1-112 [268591]
   Other proteins in same PDB: d4oz4a1, d4oz4a2, d4oz4b2, d4oz4h1, d4oz4h2, d4oz4l2
   automated match to d3hzma1

Details for d4oz4l1

PDB Entry: 4oz4, 3 Å

PDB Description: x-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.

PDB Compounds: (L:) Fab of monoclonal antibody, light chain

SCOPe Domain Sequences for d4oz4l1:

Sequence; same for both SEQRES and ATOM records:

>d4oz4l1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

Timeline for d4oz4l1:

• d4oz4l1 first appeared in SCOPe 2.05
  
• d4oz4l1 appears in SCOPe 2.07