SCOPe 2.08: Domain d4podb_: 4pod B:

Lineage for d4podb_ (4pod B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein automated matches [196175] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [268561] (2 PDB entries)

8. Domain d4podb_: 4pod B: [268579]
   automated match to d1wyia_
   complexed with br, k, na, po4; mutant

Details for d4podb_

PDB Entry: 4pod, 1.99 Å

PDB Description: Structure of Triosephosphate Isomerase I170V mutant human enzyme.

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4podb_:

Sequence; same for both SEQRES and ATOM records:

>d4podb_ c.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwavgtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinak

Timeline for d4podb_:

• d4podb_ first appeared in SCOPe 2.05
  
• d4podb_ appears in SCOPe 2.07