SCOPe 2.05: Domain d1mppa_: 1mpp A:

Lineage for d1mppa_ (1mpp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Pepsin [50663] (1 species)

7. Species Mucor pusillus [TaxId:4840] [50664] (1 PDB entry)

8. Domain d1mppa_: 1mpp A: [26856]
   complexed with so4

Details for d1mppa_

PDB Entry: 1mpp, 2 Å

PDB Description: x-ray analyses of aspartic proteinases. v. structure and refinement at 2.0 angstroms resolution of the aspartic proteinase from mucor pusillus

PDB Compounds: (A:) pepsin

SCOPe Domain Sequences for d1mppa_:

Sequence; same for both SEQRES and ATOM records:

>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]}
gsvdtpglydfdleeyaipvsigtpgqdfyllfdtgssdtwvphkgcdnsegcvgkrffd
psssstfketdynlnitygtggangiyfrdsitvggatvkqqtlayvdnvsgptaeqspd
selfldgifgaaypdntameaeygdtyntvhvnlykqglisspvfsvymntndgggqvvf
ggvnntllggdiqytdvlksrggyffwdapvtgvkidgsdavsfdgaqaftidtgtnffi
apssfaekvvkaalpdatesqqgytvpcskyqdskttfslvlqksgsssdtidvsvpisk
mllpvdksgetcmfivlpdggnqfivgnlflrffvnvydfgknrigfaplasgyend

Timeline for d1mppa_:

• d1mppa_ first appeared (with stable ids) in SCOP 1.55, called d1mpp__
  
• d1mppa_ appears in SCOPe 2.04
  
• d1mppa_ appears in SCOPe 2.06
  
• d1mppa_ appears in the current release, SCOPe 2.08