Lineage for d4pgka_ (4pgk A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729639Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 1729640Protein Hypothetical protein PMT1231 [158403] (1 species)
  7. 1729641Species Prochlorococcus marinus [TaxId:1219] [158404] (8 PDB entries)
    Uniprot Q7V6D4 20-241
  8. 1729649Domain d4pgka_: 4pgk A: [268550]
    automated match to d4kvqa_
    complexed with fe, y69

Details for d4pgka_

PDB Entry: 4pgk (more details), 2.17 Å

PDB Description: insights into substrate and metal binding from the crystal structure of cyanobacterial aldehyde deformylating oxygenase with substrate bound
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4pgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pgka_ a.25.1.6 (A:) Hypothetical protein PMT1231 {Prochlorococcus marinus [TaxId: 1219]}
alpdftsdrykdaysrinaiviegeqeahdnyiaigtllpdhveelkrlakmemrhkkgf
tacgknlgvkadmdfareffaplrdnfqtalgqgktptclliqallieafaisayhtyip
vsdpfarkitegvvkdeythlnygeawlkanlescreelleanrenlplilrmldqvagd
aavlqmdkedliedfliayqeslteigfntreitrmaaaal

SCOPe Domain Coordinates for d4pgka_:

Click to download the PDB-style file with coordinates for d4pgka_.
(The format of our PDB-style files is described here.)

Timeline for d4pgka_: