SCOPe 2.04: Domain d1am5a_: 1am5 A:

Lineage for d1am5a_ (1am5 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Pepsin(ogen) [50658] (4 species)

7. Species Atlantic cod (Gadus morhua) [TaxId:8049] [50662] (1 PDB entry)

8. Domain d1am5a_: 1am5 A: [26855]

Details for d1am5a_

PDB Entry: 1am5, 2.16 Å

PDB Description: the crystal structure and proposed amino acid sequence of a pepsin from atlantic cod (gadus morhua)

PDB Compounds: (A:) pepsin

SCOPe Domain Sequences for d1am5a_:

Sequence; same for both SEQRES and ATOM records:

>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]}
rvteqmkneadteyygvisigtppesfkvifdtgssnlwvssshcsaqacsnhnkfkprq
sstyvetgktvdltygtggmrgilgqdtvsvgggsdpnqelgesqtepgpfqaaapfdgi
lglaypsiaaagavpvfdnmgsqslvekdlfsfylsgggangsevmlggvdnshytgsih
wipvtaekywqvaldgitvngqtaacegcqaivdtgtskivapvsalanimkdigasenq
gemmgncasvqslpditftingvkqplppsayiegdqafctsglgssgvpsntselwifg
dvflrnyytiydrtnnkvgfapaa

Timeline for d1am5a_:

• d1am5a_ first appeared (with stable ids) in SCOP 1.55, called d1am5__
  
• d1am5a_ appears in SCOPe 2.03
  
• d1am5a_ appears in SCOPe 2.05
  
• d1am5a_ appears in the current release, SCOPe 2.08