Lineage for d4oubb_ (4oub B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141477Species Pseudomonas fluorescens [TaxId:294] [256773] (14 PDB entries)
  8. 2141499Domain d4oubb_: 4oub B: [268544]
    automated match to d4i1wa_
    complexed with 2vs, na, nad

Details for d4oubb_

PDB Entry: 4oub (more details), 2.19 Å

PDB Description: a 2.20 angstroms x-ray crystal structure of e268a 2-aminomucaonate 6- semialdehyde dehydrogenase catalytic intermediate from pseudomonas fluorescens
PDB Compounds: (B:) 2-aminomuconate 6-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4oubb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oubb_ c.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
iki

SCOPe Domain Coordinates for d4oubb_:

Click to download the PDB-style file with coordinates for d4oubb_.
(The format of our PDB-style files is described here.)

Timeline for d4oubb_: