Lineage for d4ou2c_ (4ou2 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141477Species Pseudomonas fluorescens [TaxId:294] [256773] (14 PDB entries)
  8. 2141504Domain d4ou2c_: 4ou2 C: [268542]
    automated match to d4i1wa_
    complexed with 6oa, na, nad

Details for d4ou2c_

PDB Entry: 4ou2 (more details), 2.15 Å

PDB Description: a 2.15 angstroms x-ray crystal structure of e268a 2-aminomuconate 6- semialdehyde dehydrogenase catalytic intermediate from pseudomonas fluorescens
PDB Compounds: (C:) 2-aminomuconate 6-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4ou2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ou2c_ c.82.1.0 (C:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
iki

SCOPe Domain Coordinates for d4ou2c_:

Click to download the PDB-style file with coordinates for d4ou2c_.
(The format of our PDB-style files is described here.)

Timeline for d4ou2c_: