![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Pepsin(ogen) [50658] (4 species) |
![]() | Species Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId:9606] [50661] (2 PDB entries) |
![]() | Domain d1avf.2: 1avf Q:,J: [26854] activation intermediate 2 complexed with na |
PDB Entry: 1avf (more details), 2.36 Å
SCOPe Domain Sequences for d1avf.2:
Sequence, based on SEQRES records: (download)
>g1avf.2 b.50.1.2 (Q:,J:) Pepsin(ogen) {Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId: 9606]} avvkvplkkfksiretmkekglXvtyepmaymdaayfgeisigtppqnflvlfdtgssnl wvpsvycqsqactshsrfnpsesstystngqtfslqygsgsltgffgydtltvqsiqvpn qefglsenepgtnfvyaqfdgimglaypalsvdeattamqgmvqegaltspvfsvylsnq qgssggavvfggvdsslytgqiywapvtqelywqigieefliggqasgwcsegcqaivdt gtslltvpqqymsallqatgaqedeygqflvncnsiqnlpsltfiingvefplppssyil snngyctvgveptylssqngqplwilgdvflrsyysvydlgnnrvgfataa
>g1avf.2 b.50.1.2 (Q:,J:) Pepsin(ogen) {Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId: 9606]} avvkvplkkfksiretmkekglXvtyepmaymdaayfgeisigtppqnflvlfdtgssnl wvpsvycqsqactshsrfnpsesstystngqtfslqygsgsltgffgydtltvqsiqvpn qefglsenepgtnfvyaqfdgimglaypalsvdeattamqgmvqegaltspvfsvylsng gavvfggvdsslytgqiywapvtqelywqigieefliggqasgwcsegcqaivdtgtsll tvpqqymsallqatgaqedeygqflvncnsiqnlpsltfiingvefplppssyilsnngy ctvgveptylssqngqplwilgdvflrsyysvydlgnnrvgfataa
Timeline for d1avf.2:
![]() Domains from other chains: (mouse over for more information) d1avf.1, d1avf.1, d1avf.1, d1avf.1 |