Lineage for d4onvc_ (4onv C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086619Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)
  8. 2086646Domain d4onvc_: 4onv C: [268537]
    automated match to d2v9da_
    complexed with edo, gol, kdg

Details for d4onvc_

PDB Entry: 4onv (more details), 2.57 Å

PDB Description: Crystal structure of YagE, a KDG aldolase protein in complex with 2-Keto-3-deoxy gluconate
PDB Compounds: (C:) Probable 2-keto-3-deoxy-galactonate aldolase YagE

SCOPe Domain Sequences for d4onvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4onvc_ c.1.10.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

SCOPe Domain Coordinates for d4onvc_:

Click to download the PDB-style file with coordinates for d4onvc_.
(The format of our PDB-style files is described here.)

Timeline for d4onvc_: