Lineage for d4omma_ (4omm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783887Species Chicken (Gallus gallus) [TaxId:9031] [225620] (11 PDB entries)
  8. 1783904Domain d4omma_: 4omm A: [268530]
    automated match to d2w10b_
    complexed with gol, peg, pge, so4; mutant

Details for d4omma_

PDB Entry: 4omm (more details)

PDB Description: Crystal structure of the intertwined dimer of the c-Src tyrosine kinase SH3 domain mutant N113S
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4omma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omma_ b.34.2.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mtfvalydyesrtetdlsfkkgerlqivnstegdwwlahslttgrtgyipsnyvaps

SCOPe Domain Coordinates for d4omma_:

Click to download the PDB-style file with coordinates for d4omma_.
(The format of our PDB-style files is described here.)

Timeline for d4omma_:

  • d4omma_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-20
  • d4omma_ is called d4omma1 in SCOPe 2.06
  • d4omma_ appears in the current release, SCOPe 2.07, called d4omma1