Lineage for d1avf.1 (1avf P:,A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060854Protein Pepsin(ogen) [50658] (4 species)
  7. 2060863Species Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId:9606] [50661] (2 PDB entries)
  8. 2060865Domain d1avf.1: 1avf P:,A: [26853]
    activation intermediate 2
    complexed with na

Details for d1avf.1

PDB Entry: 1avf (more details), 2.36 Å

PDB Description: activation intermediate 2 of human gastricsin from human stomach
PDB Compounds: (A:) gastricsin, (P:) gastricsin

SCOPe Domain Sequences for d1avf.1:

Sequence, based on SEQRES records: (download)

>g1avf.1 b.50.1.2 (P:,A:) Pepsin(ogen) {Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId: 9606]}
avvkvplkkfksiretmkekgXvtyepmaymdaayfgeisigtppqnflvlfdtgssnlw
vpsvycqsqactshsrfnpsesstystngqtfslqygsgsltgffgydtltvqsiqvpnq
efglsenepgtnfvyaqfdgimglaypalsvdeattamqgmvqegaltspvfsvylsnqq
gssggavvfggvdsslytgqiywapvtqelywqigieefliggqasgwcsegcqaivdtg
tslltvpqqymsallqatgaqedeygqflvncnsiqnlpsltfiingvefplppssyils
nngyctvgveptylssqngqplwilgdvflrsyysvydlgnnrvgfataa

Sequence, based on observed residues (ATOM records): (download)

>g1avf.1 b.50.1.2 (P:,A:) Pepsin(ogen) {Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId: 9606]}
avvkvplkkfksiretmkekgXvtyepmaymdaayfgeisigtppqnflvlfdtgssnlw
vpsvycqsqactshsrfnpsesstystngqtfslqysgsltgffgydtltvqsiqvpnqe
fglsenepgtnfvyaqfdgimglaypalsvdeattamqgmvqegaltspvfsvylsngga
vvfggvdsslytgqiywapvtqelywqigieefliggqasgwcsegcqaivdtgtslltv
pqqymsallqatgaqedeygqflvncnsiqnlpsltfiingvefplppssyilsnngyct
vgveptylssqngqplwilgdvflrsyysvydlgnnrvgfataa

SCOPe Domain Coordinates for d1avf.1:

Click to download the PDB-style file with coordinates for d1avf.1.
(The format of our PDB-style files is described here.)

Timeline for d1avf.1: