SCOPe 2.08: Domain d4or1a1: 4or1 A:1-143

Lineage for d4or1a1 (4or1 A:1-143)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)

8. Domain d4or1a1: 4or1 A:1-143 [268529]
   Other proteins in same PDB: d4or1a2, d4or1b2
   automated match to d4phxc_
   complexed with act, so4

Details for d4or1a1

PDB Entry: 4or1, 3 Å

PDB Description: structure and mechanism of fibronectin binding and biofilm formation of enteroaggregative escherischia coli aaf fimbriae

PDB Compounds: (A:) Invasin homolog AafB, Major fimbrial subunit of aggregative adherence fimbria II AafA chimeric construct

SCOPe Domain Sequences for d4or1a1:

Sequence, based on SEQRES records:

>d4or1a1 b.2.3.0 (A:1-143) automated matches {Escherichia coli [TaxId: 562]}
teisleglhrnmgeqlfdgdilatgriicrerhtgfhiqmnarqvegrpghyivqgskdt
qsklwvrlgregwtsptgggqqgivrsgqeeqvifdvmadgnqwakpgeyifsvsgkclt
swednkqnatavaktatstitvv

Sequence, based on observed residues (ATOM records):

>d4or1a1 b.2.3.0 (A:1-143) automated matches {Escherichia coli [TaxId: 562]}
teisleglhnmgeqlfdgdilatgriicrerhtgfhiqmnarqvegrpghyivqgskdtq
sklwvrlgregwtspqgivrsgqeeqvifdvmadgnqwakpgeyifsvsgkclttavakt
atstitvv

Timeline for d4or1a1:

• d4or1a1 first appeared in SCOPe 2.05, called d4or1a_
  
• d4or1a1 appears in SCOPe 2.07