![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187451] (6 PDB entries) |
![]() | Domain d4or1a1: 4or1 A:1-143 [268529] Other proteins in same PDB: d4or1a2, d4or1b2 automated match to d4phxc_ complexed with act, so4 |
PDB Entry: 4or1 (more details), 3 Å
SCOPe Domain Sequences for d4or1a1:
Sequence, based on SEQRES records: (download)
>d4or1a1 b.2.3.0 (A:1-143) automated matches {Escherichia coli [TaxId: 562]} teisleglhrnmgeqlfdgdilatgriicrerhtgfhiqmnarqvegrpghyivqgskdt qsklwvrlgregwtsptgggqqgivrsgqeeqvifdvmadgnqwakpgeyifsvsgkclt swednkqnatavaktatstitvv
>d4or1a1 b.2.3.0 (A:1-143) automated matches {Escherichia coli [TaxId: 562]} teisleglhnmgeqlfdgdilatgriicrerhtgfhiqmnarqvegrpghyivqgskdtq sklwvrlgregwtspqgivrsgqeeqvifdvmadgnqwakpgeyifsvsgkclttavakt atstitvv
Timeline for d4or1a1: