Lineage for d4ol7b_ (4ol7 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787539Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1787540Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1787781Protein automated matches [190761] (2 species)
    not a true protein
  7. 1787782Species Staphylococcus aureus [TaxId:1280] [188650] (41 PDB entries)
  8. 1787815Domain d4ol7b_: 4ol7 B: [268526]
    automated match to d2lkva_
    complexed with ca, thp

Details for d4ol7b_

PDB Entry: 4ol7 (more details), 1.67 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
PDB Compounds: (B:) Thermonuclease

SCOPe Domain Sequences for d4ol7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ol7b_ b.40.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmeenak
kievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllrkaea
qakkeklniwse

SCOPe Domain Coordinates for d4ol7b_:

Click to download the PDB-style file with coordinates for d4ol7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ol7b_: