SCOPe 2.06: Domain d4ooib_: 4ooi B:

Lineage for d4ooib_ (4ooi B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [256837] (2 PDB entries)

8. Domain d4ooib_: 4ooi B: [268524]
   automated match to d3jtha_

Details for d4ooib_

PDB Entry: 4ooi, 2.2 Å

PDB Description: Reduced HlyU from Vibrio cholerae N16961

PDB Compounds: (B:) Transcriptional activator HlyU

SCOPe Domain Sequences for d4ooib_:

Sequence; same for both SEQRES and ATOM records:

>d4ooib_ a.4.5.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
nlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlr
rdglvntrkeaqtvfytlsstevkamiellhrlycq

Timeline for d4ooib_:

• d4ooib_ first appeared in SCOPe 2.05
  
• d4ooib_ appears in SCOPe 2.07
  
• d4ooib_ appears in the current release, SCOPe 2.08