SCOPe 2.06: Domain d4ojaa1: 4oja A:4-151

Lineage for d4ojaa1 (4oja A:4-151)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.0: automated matches [191527] (1 protein)
   not a true family

6. Protein automated matches [190890] (7 species)
   not a true protein

7. Species Hydra vulgaris [TaxId:6087] [268522] (1 PDB entry)

8. Domain d4ojaa1: 4oja A:4-151 [268523]
   Other proteins in same PDB: d4ojaa2
   automated match to d1to4a_
   complexed with cu, so4, zn

Details for d4ojaa1

PDB Entry: 4oja, 2.28 Å

PDB Description: Structure of Hydra Cu-Zn superoxide dismutase

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d4ojaa1:

Sequence; same for both SEQRES and ATOM records:

>d4ojaa1 b.1.8.0 (A:4-151) automated matches {Hydra vulgaris [TaxId: 6087]}
saicvlegivkgtikfedigdgkthvsgkitglqppgkhgfhihqfgdysggcmstgphf
npfnkehggpedenrhagdlgnivsddygnadvniedsqipldgpnsiigralvvhqned
dlglgghkdskttgnagarlscgvigla

Timeline for d4ojaa1:

• d4ojaa1 first appeared in SCOPe 2.05, called d4ojaa_
  
• d4ojaa1 appears in SCOPe 2.07
  
• d4ojaa1 appears in the current release, SCOPe 2.08