Lineage for d4ojaa1 (4oja A:4-151)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764486Species Hydra vulgaris [TaxId:6087] [268522] (1 PDB entry)
  8. 2764487Domain d4ojaa1: 4oja A:4-151 [268523]
    Other proteins in same PDB: d4ojaa2
    automated match to d1to4a_
    complexed with cu, so4, zn

Details for d4ojaa1

PDB Entry: 4oja (more details), 2.28 Å

PDB Description: Structure of Hydra Cu-Zn superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d4ojaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ojaa1 b.1.8.0 (A:4-151) automated matches {Hydra vulgaris [TaxId: 6087]}
saicvlegivkgtikfedigdgkthvsgkitglqppgkhgfhihqfgdysggcmstgphf
npfnkehggpedenrhagdlgnivsddygnadvniedsqipldgpnsiigralvvhqned
dlglgghkdskttgnagarlscgvigla

SCOPe Domain Coordinates for d4ojaa1:

Click to download the PDB-style file with coordinates for d4ojaa1.
(The format of our PDB-style files is described here.)

Timeline for d4ojaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ojaa2