![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Hydra vulgaris [TaxId:6087] [268522] (1 PDB entry) |
![]() | Domain d4ojaa1: 4oja A:4-151 [268523] Other proteins in same PDB: d4ojaa2 automated match to d1to4a_ complexed with cu, so4, zn |
PDB Entry: 4oja (more details), 2.28 Å
SCOPe Domain Sequences for d4ojaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ojaa1 b.1.8.0 (A:4-151) automated matches {Hydra vulgaris [TaxId: 6087]} saicvlegivkgtikfedigdgkthvsgkitglqppgkhgfhihqfgdysggcmstgphf npfnkehggpedenrhagdlgnivsddygnadvniedsqipldgpnsiigralvvhqned dlglgghkdskttgnagarlscgvigla
Timeline for d4ojaa1: