| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries) |
| Domain d4odca_: 4odc A: [268521] Other proteins in same PDB: d4odcb_ automated match to d1s5xa_ complexed with cyn, gol, hem |
PDB Entry: 4odc (more details), 1.54 Å
SCOPe Domain Sequences for d4odca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odca_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr
Timeline for d4odca_: