SCOPe 2.06: Domain d4ohqa_: 4ohq A:

Lineage for d4ohqa_ (4ohq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (21 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [268515] (2 PDB entries)

8. Domain d4ohqa_: 4ohq A: [268520]
   automated match to d1m6ja_

Details for d4ohqa_

PDB Entry: 4ohq, 2.15 Å

PDB Description: crystal structure of chloroplast triose phosphate isomerase from arabidopsis thaliana

PDB Compounds: (A:) Triosephosphate isomerase, chloroplastic

SCOPe Domain Sequences for d4ohqa_:

Sequence; same for both SEQRES and ATOM records:

>d4ohqa_ c.1.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gkffvggnwkcngtkdsiaklisdlnsatleadvdvvvsppfvyidqvkssltdridisg
qnswvgkggaftgeisveqlkdlgckwvilghserrhvigekdefigkkaayalseglgv
iacigekleereagktfdvcfaqlkafadavpswdnivvayepvwaigtgkvaspqqaqe
vhvavrgwlkknvseevasktriiyggsvnggnsaelakeedidgflvggaslkgpefat
ivnsvtskkv

Timeline for d4ohqa_:

• d4ohqa_ first appeared in SCOPe 2.05
  
• d4ohqa_ appears in SCOPe 2.07
  
• d4ohqa_ appears in the current release, SCOPe 2.08