Lineage for d1htr.1 (1htr P:,B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802095Protein Pepsin(ogen) [50658] (4 species)
  7. 2802104Species Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId:9606] [50661] (2 PDB entries)
  8. 2802105Domain d1htr.1: 1htr P:,B: [26852]

Details for d1htr.1

PDB Entry: 1htr (more details), 1.62 Å

PDB Description: crystal and molecular structures of human progastricsin at 1.62 angstroms resolution
PDB Compounds: (B:) gastricsin, (P:) progastricsin (pro segment)

SCOPe Domain Sequences for d1htr.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1htr.1 b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens), progastricsin (pepsinogen C) [TaxId: 9606]}
avvkvplkkfksiretmkekgllgeflrthkydpawkyrfgdlXsvtyepmaymdaayfg
eisigtppqnflvlfdtgssnlwvpsvycqsqactshsrfnpsesstystngqtfslqyg
sgsltgffgydtltvqsiqvpnqefglsenepgtnfvyaqfdgimglaypalsvdeatta
mqgmvqegaltspvfsvylsnqqgssggavvfggvdsslytgqiywapvtqelywqigie
efliggqasgwcsegcqaivdtgtslltvpqqymsallqatgaqedeygqflvncnsiqn
lpsltfiingvefplppssyilsnngyctvgveptylssqngqplwilgdvflrsyysvy
dlgnnrvgfataa

SCOPe Domain Coordinates for d1htr.1:

Click to download the PDB-style file with coordinates for d1htr.1.
(The format of our PDB-style files is described here.)

Timeline for d1htr.1: