SCOPe 2.07: Domain d4odcb_: 4odc B:

Lineage for d4odcb_ (4odc B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)

8. Domain d4odcb_: 4odc B: [268518]
   Other proteins in same PDB: d4odca_
   automated match to d1pbxb_
   complexed with cyn, gol, hem

Details for d4odcb_

PDB Entry: 4odc, 1.54 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partially cyanided state

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4odcb_:

Sequence; same for both SEQRES and ATOM records:

>d4odcb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d4odcb_:

• d4odcb_ first appeared in SCOPe 2.05
  
• d4odcb_ appears in SCOPe 2.06
  
• d4odcb_ appears in the current release, SCOPe 2.08