SCOPe 2.07: Domain d4oepb1: 4oep B:18-110

Lineage for d4oepb1 (4oep B:18-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)

8. Domain d4oepb1: 4oep B:18-110 [268514]
   Other proteins in same PDB: d4oepa2, d4oepa3, d4oepb2, d4oepb3
   automated match to d2rrma_
   complexed with 12p, act

Details for d4oepb1

PDB Entry: 4oep, 2.35 Å

PDB Description: crystal structure of the zo-1 pdz1 domain in complex with the 7-mer claudin1 c-terminal tail

PDB Compounds: (B:) Tight junction protein ZO-1

SCOPe Domain Sequences for d4oepb1:

Sequence; same for both SEQRES and ATOM records:

>d4oepb1 b.36.1.1 (B:18-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam
vngvsmdnvehafavqqlrksgknakitirrkk

Timeline for d4oepb1:

• d4oepb1 first appeared in SCOPe 2.05, called d4oepb_
  
• d4oepb1 appears in SCOPe 2.06
  
• d4oepb1 appears in the current release, SCOPe 2.08