Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d4oepb1: 4oep B:18-110 [268514] Other proteins in same PDB: d4oepa2, d4oepa3, d4oepb2, d4oepb3 automated match to d2rrma_ complexed with 12p, act |
PDB Entry: 4oep (more details), 2.35 Å
SCOPe Domain Sequences for d4oepb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oepb1 b.36.1.1 (B:18-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam vngvsmdnvehafavqqlrksgknakitirrkk
Timeline for d4oepb1: