Lineage for d1psn__ (1psn -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Pepsin(ogen) [50658] (4 species) 
Species Human (Homo sapiens), 3A [TaxId:9606] [50660] (3 PDB entries) 
Domain d1psn__: 1psn - [26851]
Details for d1psn__
PDB Entry: 1psn (more details), 2.2 Å
PDB Description: the crystal structure of human pepsin and its complex with pepstatin
SCOP Domain Sequences for d1psn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psn__ b.50.1.2 (-) Pepsin(ogen) {Human (Homo sapiens), 3A}
vdeqplenyldmeyfgtigigtpaqdftvvfdtgssnlwvpsvycsslactnhnrfnped
sstyqstsetvsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisssgatpvfdniwnqglvsqdlfsvylsaddqsgsvvifggidssyytgsln
wvpvtvegywqitvdsitmngeaiacaegcqaivdtgtslltgptspianiqsdigasen
sdgdmvvscsaisslpdivftingvqypvppsayilqsegscisgfqgmnlptesgelwi
lgdvfirqyftvfdrannqvglapva
SCOP Domain Coordinates for d1psn__:
Click to download the PDB-style file with coordinates for d1psn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1psn__:
- d1psn__ appears in SCOP 1.57
- d1psn__ appears in the current release, SCOPe 2.08, called d1psna_
View in 3D