SCOPe 2.06: Domain d1qrpe_: 1qrp E:

Lineage for d1qrpe_ (1qrp E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Pepsin(ogen) [50658] (4 species)

7. Species Human (Homo sapiens), isoform 3A [TaxId:9606] [50660] (5 PDB entries)

8. Domain d1qrpe_: 1qrp E: [26850]
   complexed with hh0

Details for d1qrpe_

PDB Entry: 1qrp, 1.96 Å

PDB Description: human pepsin 3a in complex with a phosphonate inhibitor iva-val-val-leu(p)-(o)phe-ala-ala-ome

PDB Compounds: (E:) pepsin 3a

SCOPe Domain Sequences for d1qrpe_:

Sequence; same for both SEQRES and ATOM records:

>d1qrpe_ b.50.1.2 (E:) Pepsin(ogen) {Human (Homo sapiens), isoform 3A [TaxId: 9606]}
vdeqplenyldmeyfgtigigtpaqdftvvfdtgssnlwvpsvycsslactnhnrfnped
sstyqstsetvsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisssgatpvfdniwnqglvsqdlfsvylsaddqsgsvvifggidssyytgsln
wvpvtvegywqitvdsitmngeaiacaegcqaivdtgtslltgptspianiqsdigasen
sdgdmvvscsaisslpdivftingvqypvppsayilqsegscisgfqgmnlptesgelwi
lgdvfirqyftvfdrannqvglapva

Timeline for d1qrpe_:

• d1qrpe_ first appeared (with stable ids) in SCOP 1.55
  
• d1qrpe_ appears in SCOPe 2.05
  
• d1qrpe_ appears in SCOPe 2.07
  
• d1qrpe_ appears in the current release, SCOPe 2.08