Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d4oeoc1: 4oeo C:18-110 [268496] Other proteins in same PDB: d4oeoa2, d4oeob2, d4oeoc2 automated match to d2h2ba_ complexed with 12p, act, so4 |
PDB Entry: 4oeo (more details), 1.9 Å
SCOPe Domain Sequences for d4oeoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oeoc1 b.36.1.1 (C:18-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam vngvsmdnvehafavqqlrksgknakitirrkk
Timeline for d4oeoc1:
View in 3D Domains from other chains: (mouse over for more information) d4oeoa1, d4oeoa2, d4oeob1, d4oeob2 |