Lineage for d4oeoc1 (4oeo C:18-110)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395911Domain d4oeoc1: 4oeo C:18-110 [268496]
    Other proteins in same PDB: d4oeoa2, d4oeob2, d4oeoc2
    automated match to d2h2ba_
    complexed with 12p, act, so4

Details for d4oeoc1

PDB Entry: 4oeo (more details), 1.9 Å

PDB Description: high resolution crystal structure of the unliganded zo-1 pdz1 domain
PDB Compounds: (C:) Tight junction protein ZO-1

SCOPe Domain Sequences for d4oeoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oeoc1 b.36.1.1 (C:18-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam
vngvsmdnvehafavqqlrksgknakitirrkk

SCOPe Domain Coordinates for d4oeoc1:

Click to download the PDB-style file with coordinates for d4oeoc1.
(The format of our PDB-style files is described here.)

Timeline for d4oeoc1: