SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4oe2b_ (4oe2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (40 species)
    not a true protein
  7. 2141477Species Pseudomonas fluorescens [TaxId:294] [256773] (14 PDB entries)
  8. 2141491Domain d4oe2b_: 4oe2 B: [268493]
    automated match to d4i1wa_
    complexed with gol, na, nad

Details for d4oe2b_

PDB Entry: 4oe2 (more details), 2 Å

PDB Description: 2.00 Angstroms X-ray crystal structure of E268A 2-aminomuconate 6-semialdehyde dehydrogenase from Pseudomonas fluorescens
PDB Compounds: (B:) 2-aminomuconate 6-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4oe2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oe2b_ c.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
iki

SCOPe Domain Coordinates for d4oe2b_:

Click to download the PDB-style file with coordinates for d4oe2b_.
(The format of our PDB-style files is described here.)

Timeline for d4oe2b_: