Lineage for d1psoe_ (1pso E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802095Protein Pepsin(ogen) [50658] (4 species)
  7. 2802098Species Human (Homo sapiens), isoform 3A [TaxId:9606] [50660] (5 PDB entries)
  8. 2802099Domain d1psoe_: 1pso E: [26849]

Details for d1psoe_

PDB Entry: 1pso (more details), 2 Å

PDB Description: The crystal structure of human pepsin and its complex with pepstatin
PDB Compounds: (E:) pepsin 3a

SCOPe Domain Sequences for d1psoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psoe_ b.50.1.2 (E:) Pepsin(ogen) {Human (Homo sapiens), isoform 3A [TaxId: 9606]}
vdeqplenyldmeyfgtigigtpaqdftvvfdtgssnlwvpsvycsslactnhnrfnped
sstyqstsetvsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisssgatpvfdniwnqglvsqdlfsvylsaddqsgsvvifggidssyytgsln
wvpvtvegywqitvdsitmngeaiacaegcqaivdtgtslltgptspianiqsdigasen
sdgdmvvscsaisslpdivftingvqypvppsayilqsegscisgfqgmnlptesgelwi
lgdvfirqyftvfdrannqvglapva

SCOPe Domain Coordinates for d1psoe_:

Click to download the PDB-style file with coordinates for d1psoe_.
(The format of our PDB-style files is described here.)

Timeline for d1psoe_: