Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Pepsin(ogen) [50658] (4 species) |
Species Human (Homo sapiens), isoform 3A [TaxId:9606] [50660] (5 PDB entries) |
Domain d1psoe_: 1pso E: [26849] |
PDB Entry: 1pso (more details), 2 Å
SCOPe Domain Sequences for d1psoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psoe_ b.50.1.2 (E:) Pepsin(ogen) {Human (Homo sapiens), isoform 3A [TaxId: 9606]} vdeqplenyldmeyfgtigigtpaqdftvvfdtgssnlwvpsvycsslactnhnrfnped sstyqstsetvsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi lglaypsisssgatpvfdniwnqglvsqdlfsvylsaddqsgsvvifggidssyytgsln wvpvtvegywqitvdsitmngeaiacaegcqaivdtgtslltgptspianiqsdigasen sdgdmvvscsaisslpdivftingvqypvppsayilqsegscisgfqgmnlptesgelwi lgdvfirqyftvfdrannqvglapva
Timeline for d1psoe_: