SCOPe 2.07: Domain d4ocia1: 4oci A:8-138

Lineage for d4ocia1 (4oci A:8-138)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:885318] [268485] (1 PDB entry)

8. Domain d4ocia1: 4oci A:8-138 [268486]
   Other proteins in same PDB: d4ocia2
   automated match to d2otgc_
   complexed with act, ca, na

Details for d4ocia1

PDB Entry: 4oci, 2.01 Å

PDB Description: crystal structure of calcium binding protein-5 from entamoeba histolytica and its involvement in initiation of phagocytosis of human erythrocytes

PDB Compounds: (A:) Calmodulin, putative

SCOPe Domain Sequences for d4ocia1:

Sequence; same for both SEQRES and ATOM records:

>d4ocia1 a.39.1.0 (A:8-138) automated matches {Entamoeba histolytica [TaxId: 885318]}
lkesfllfdgdgdgyltlnefeslvrvlgvvmetsaiastynsnskvrgmsyelftscfs
qlktksfnkdeiktainvldkdkkgfipaielrrilstigdnmeqkeitdlftfmgideq
gvvkvddfinq

Timeline for d4ocia1:

• d4ocia1 first appeared in SCOPe 2.05, called d4ocia_
  
• d4ocia1 appears in SCOPe 2.06
  
• d4ocia1 appears in the current release, SCOPe 2.08