Lineage for d4ocia1 (4oci A:8-138)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711634Species Entamoeba histolytica [TaxId:885318] [268485] (1 PDB entry)
  8. 2711635Domain d4ocia1: 4oci A:8-138 [268486]
    Other proteins in same PDB: d4ocia2
    automated match to d2otgc_
    complexed with act, ca, na

Details for d4ocia1

PDB Entry: 4oci (more details), 2.01 Å

PDB Description: crystal structure of calcium binding protein-5 from entamoeba histolytica and its involvement in initiation of phagocytosis of human erythrocytes
PDB Compounds: (A:) Calmodulin, putative

SCOPe Domain Sequences for d4ocia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ocia1 a.39.1.0 (A:8-138) automated matches {Entamoeba histolytica [TaxId: 885318]}
lkesfllfdgdgdgyltlnefeslvrvlgvvmetsaiastynsnskvrgmsyelftscfs
qlktksfnkdeiktainvldkdkkgfipaielrrilstigdnmeqkeitdlftfmgideq
gvvkvddfinq

SCOPe Domain Coordinates for d4ocia1:

Click to download the PDB-style file with coordinates for d4ocia1.
(The format of our PDB-style files is described here.)

Timeline for d4ocia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ocia2