SCOPe 2.06: Domain d4oapb_: 4oap B:

Lineage for d4oapb_ (4oap B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (12 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [236728] (8 PDB entries)

8. Domain d4oapb_: 4oap B: [268483]
   automated match to d4jhla_
   complexed with act, cl, gol; mutant

Details for d4oapb_

PDB Entry: 4oap, 1.93 Å

PDB Description: An Axe2 mutant (W190I), an acetyl-xylooligosaccharide esterase from Geobacillus Stearmophilus

PDB Compounds: (B:) acetyl xylan esterase

SCOPe Domain Sequences for d4oapb_:

Sequence; same for both SEQRES and ATOM records:

>d4oapb_ c.23.10.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalaidrvhpsvaghmilaraflreigfewvrsr

Timeline for d4oapb_:

• d4oapb_ first appeared in SCOPe 2.05
  
• d4oapb_ appears in SCOPe 2.07
  
• d4oapb_ appears in the current release, SCOPe 2.08