Lineage for d4oapb_ (4oap B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857542Species Geobacillus stearothermophilus [TaxId:1422] [236728] (8 PDB entries)
  8. 2857548Domain d4oapb_: 4oap B: [268483]
    automated match to d4jhla_
    complexed with act, cl, gol; mutant

Details for d4oapb_

PDB Entry: 4oap (more details), 1.93 Å

PDB Description: An Axe2 mutant (W190I), an acetyl-xylooligosaccharide esterase from Geobacillus Stearmophilus
PDB Compounds: (B:) acetyl xylan esterase

SCOPe Domain Sequences for d4oapb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oapb_ c.23.10.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalaidrvhpsvaghmilaraflreigfewvrsr

SCOPe Domain Coordinates for d4oapb_:

Click to download the PDB-style file with coordinates for d4oapb_.
(The format of our PDB-style files is described here.)

Timeline for d4oapb_: