SCOPe 2.05: Domain d4o7ya_: 4o7y A:

Lineage for d4o7ya_ (4o7y A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.0: automated matches [191445] (1 protein)
   not a true family

6. Protein automated matches [190664] (7 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [194472] (16 PDB entries)

8. Domain d4o7ya_: 4o7y A: [268477]
   automated match to d2z02a_
   complexed with act, c5p, po4

Details for d4o7ya_

PDB Entry: 4o7y, 2 Å

PDB Description: SAICAR synthetase (Type-2) in complex with CMP

PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d4o7ya_:

Sequence; same for both SEQRES and ATOM records:

>d4o7ya_ d.143.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
kakkmipidddklimefkddatafdgtkkarfkgkgwlnaqlsviffklleehgikthfi
gvaggnrlivekldmyplevvvrnvvagslkkrlplpegyelpepivelyykndelhdpm
inyyhakvlgisldeikkieeialkvneilkdylakkgiilvdfklefgkdkngdivlad
eispdtcrfwdaktkrsldkdvfrfdkgdlieaykeiyeritgekpef

Timeline for d4o7ya_:

• d4o7ya_ is new in SCOPe 2.05-stable
  
• d4o7ya_ appears in SCOPe 2.06
  
• d4o7ya_ appears in the current release, SCOPe 2.08